PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo22G0020200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 441aa    MW: 48112.1 Da    PI: 6.2444
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo22G0020200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591.1e-184289148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ede+l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Spipo22G0020200 42 KGPWTSAEDEILKDYVKKHGEGNWNAVQKHSGLLRCGKSCRLRWTNHL 89
                     79******************************99***********996 PP

2Myb_DNA-binding53.46.1e-1795138146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+el+v+++ ++G++ W++ a +++ gRt++++k++w++
  Spipo22G0020200  95 KGPFSEEEEELIVELHSKMGNK-WARMATHLP-GRTDNEIKNFWNT 138
                      79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.553789IPR017930Myb domain
SuperFamilySSF466898.61E-3139136IPR009057Homeodomain-like
SMARTSM007174.7E-164191IPR001005SANT/Myb domain
PfamPF002495.2E-164289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-244396IPR009057Homeodomain-like
CDDcd001676.69E-134489No hitNo description
PROSITE profilePS5129426.75390144IPR017930Myb domain
SMARTSM007172.4E-1794142IPR001005SANT/Myb domain
PfamPF002491.3E-1595138IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2697143IPR009057Homeodomain-like
CDDcd001671.13E-7105140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MSHVSTDSDN GSLALKYQSE SNSMGESSSG GSISGGDGNL KKGPWTSAED EILKDYVKKH  60
GEGNWNAVQK HSGLLRCGKS CRLRWTNHLR PNLKKGPFSE EEEELIVELH SKMGNKWARM  120
ATHLPGRTDN EIKNFWNTRL KRRQRAGLPI YPPHIAQAKQ GNMQNNEPPQ QQSQDFGDSI  180
FKRFKASTEP LSHALQFPDS SYGHMLNQGL GYQTSGFITQ TGDFLKYLQD SEALFPFMDG  240
NATYGRPAYD QFPIPERIYR PSARDFPHDP DPGSGSFVTS AGMGPGGRLY PVVNFSTSQP  300
SPVAEKSELP SLQYSEPRLG SWPRSSSASI EAPDDHVDSP EMVSATSDCV STRNSGLLET  360
VIHESKALAS EKNRPAEMIP YNPTTPLLDP ANAWKTDMGG SADPLSAFDS STASVFFPLT  420
RSASGSSLDE SAVGRTSNGE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31361431107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251856.11e-123PREDICTED: transcription factor GAMYB
RefseqXP_010251855.11e-123PREDICTED: transcription factor GAMYB
RefseqXP_010251854.11e-123PREDICTED: transcription factor GAMYB
TrEMBLM0S0M31e-118M0S0M3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P17150_0011e-117(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.16e-75myb domain protein 33